Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement decay-accelerating factor (CD55), partial

Product Specifications

Product Name Alternative

Complement decay-accelerating factor (CD antigen CD55)

Abbreviation

Recombinant Human CD55 protein, partial

Gene Name

CD55

UniProt

P08174

Expression Region

35-126aa

Organism

Homo sapiens (Human)

Target Sequence

DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade (PubMed:7525274) . Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage (PubMed:28657829) .; (Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.; (Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable) .; (Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.4 kDa

References & Citations

"Human rhinovirus 87 and enterovirus 68 represent a unique serotype with rhinovirus and enterovirus features." Blomqvist S., Savolainen C., Raman L., Roivainen M., Hovi T. J. Clin. Microbiol. 40:4218-4223 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VAC14 Recombinant Protein Antigen
NBP3-17962PEP 100 µL

VAC14 Recombinant Protein Antigen

Ask
View Details
Pipette Filter tips, 100-1250 uL, Natural, Bulk, DNase/RNase free - 500 un. - ABDOS
P11016 500 Units/Pack

Pipette Filter tips, 100-1250 uL, Natural, Bulk, DNase/RNase free - 500 un. - ABDOS

Ask
View Details
KLK3 Antibody
A18384-100UG 100 µg

KLK3 Antibody

Ask
View Details
RN5S243 Protein Lysate (Human) with C-Ha Tag
39811031 100 µg

RN5S243 Protein Lysate (Human) with C-Ha Tag

Ask
View Details
SD 1008 50mg
A15364-50 50 mg

SD 1008 50mg

Ask
View Details
Recombinant Canine TNF-alpha Protein
NBP2-34916-5ug 5 µg

Recombinant Canine TNF-alpha Protein

Ask
View Details