Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF-alpha/TNFSF2, Mouse (156a.a)

Tumour Necrosis Factor alpha (TNF alpha) is a potent pro-inflammatory cytokine[1]. TNF alpha binds to its receptors, mainly TNFR1 and TNFR2, and then transmits molecular signals for biological functions such as inflammation and cell death[2]. TNF alpha stimulates NF-κB pathway via TNFR2 promotes cancer growth, invasion, and metastasis. Anti-TNF-α MAb significantly suppresses the tumor development in colitis-associated cancer (CAC) mouse[3]. TNF alpha as a proneurogenic factor activates the SAPK/JNK Pathway and can facilitate neuronal replacement and brain repair in response to brain injury[4]. TNF-alpha/TNFSF2 Protein, Mouse (156a.a) is a recombinant protein consisting of 156 amino acids (L80-L235) and is produced in E. coli.

Product Specifications

Product Name Alternative

TNF-alpha/TNFSF2 Protein, Mouse (156a.a), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnf-alpha-tnfsf2-protein-mouse.html

Purity

98.0

Smiles

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Formula

21926 (Gene_ID) P06804 (L80-L235) (Accession)

Molecular Weight

Approximately 17.3 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Zelová H, et al. TNF-α signalling and inflammation: interactions between old acquaintances. Inflamm Res. 2013 Jul;62 (7) :641-51.|[2]Horiuchi T, et al. Transmembrane TNF-alpha: structure, function and interaction with anti-TNF agents. Rheumatology (Oxford) . 2010 Jul;49 (7) :1215-28.|[3]El-Tahan RR, et al. TNF-α gene polymorphisms and expression. Springerplus. 2016 Sep 7;5 (1) :1508.|[4]Jang DI, et al. The Role of Tumor Necrosis Factor Alpha (TNF-α) in Autoimmune Disease and Current TNF-α Inhibitors in Therapeutics. Int J Mol Sci. 2021 Mar 8;22 (5) :2719.|[5]Berguetti T, et al. TNF-α Modulates P-Glycoprotein Expression and Contributes to Cellular Proliferation via Extracellular Vesicles. Cells. 2019 May 24;8 (5) :500.|[6]Onizawa M, et al. Signaling pathway via TNF-alpha/NF-kappaB in intestinal epithelial cells may be directly involved in colitis-associated carcinogenesis. Am J Physiol Gastrointest Liver Physiol. 2009 Apr;296 (4) :G850-9.|[7]Bernardino L, et al. Tumor necrosis factor-alpha modulates survival, proliferation, and neuronal differentiation in neonatal subventricular zone cell cultures. Stem Cells. 2008 Sep;26 (9) :2361-71.|[8]Matsuno H, et al. The role of TNF-alpha in the pathogenesis of inflammation and joint destruction in rheumatoid arthritis (RA) : a study using a human RA/SCID mouse chimera. Rheumatology (Oxford) . 2002 Mar;41 (3) :329-37.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monoamine Oxidase A Rabbit pAb
E45R20583N-100 100 µL

Monoamine Oxidase A Rabbit pAb

Ask
View Details
ART1, ID GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1, Mono(ADP-ribosyl)Transferase, CD296) (MaxLight 750)
MBS6464108-01 0.1 mL

ART1, ID GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1, Mono(ADP-ribosyl)Transferase, CD296) (MaxLight 750)

Ask
View Details
ART1, ID GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1, Mono(ADP-ribosyl)Transferase, CD296) (MaxLight 750)
MBS6464108-02 5x 0.1 mL

ART1, ID GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1, Mono(ADP-ribosyl)Transferase, CD296) (MaxLight 750)

Ask
View Details
RPL31P17 CRISPRa sgRNA lentivector (set of three targets)(Human)
41356121 3 x 1.0μg DNA

RPL31P17 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)
MBS2067910-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)
MBS2067910-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)

Ask
View Details