Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet basic protein (PPBP), partial

Product Specifications

Product Name Alternative

C-X-C motif chemokine 7Leukocyte-derived growth factor ; LDGFMacrophage-derived growth factor ; MDGFSmall-inducible cytokine B7

Abbreviation

Recombinant Human PPBP protein, partial

Gene Name

PPBP

UniProt

P02775

Expression Region

59-125aa

Organism

Homo sapiens (Human)

Target Sequence

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are choattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chokine-induced neutrophil activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2 (73), NAP-2 (74), NAP-2 (1-66), and most potent NAP-2 (1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III (1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.

Molecular Weight

34.4 kDa

References & Citations

Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.Wenger R.H., Wicki A.N., Walz A., Kieffer N., Clemetson K.J.Blood 73:1498-1503 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12549876/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sult2b1 ORF Vector (Mouse) (pORF)
45860014 1.0 µg DNA

Sult2b1 ORF Vector (Mouse) (pORF)

Ask
View Details
CD47 Monoclonal Antibody
TA399520 100 µg

CD47 Monoclonal Antibody

Ask
View Details
APO CRISPR/Cas9 KO Plasmid (h)
sc-413725 20 µg

APO CRISPR/Cas9 KO Plasmid (h)

Ask
View Details
Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit
MBS1600070-01 48 Well

Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit

Ask
View Details
Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit
MBS1600070-02 96 Well

Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit

Ask
View Details
Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit
MBS1600070-03 5x 96 Well

Rat Potassium channel subfamily K member 3, KCNK3 ELISA Kit

Ask
View Details