Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 6a protein E4 (E4)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human papillomavirus type 6a E4 protein

Gene Name

E4

UniProt

Q84295

Expression Region

1-91aa

Organism

Human papillomavirus type 6a

Target Sequence

MADDSALHKKYPFLNLLHTPPHRPPPLCPQAPRKTQCKRRLENEHEESNSHLATPCVWPTLDPWTVETTTSSLTITTSTKEGTTVTVQLRL

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Contributes to multiple aspects of the viral life cycle including viral genome amplification, suppression of suprabasal cell differentiation and egress of newly formed virions. Induces host cell cycle arrest at the G2 phase by associating with and preventing the nuclear entry of host CDK1/cyclin B1 complexes. Inhibits cellular DNA replication by preventing loading of host replication licensing proteins MCM2 and MCM7 onto chromatin. Within the cytoplasm, associates with host kinase SRPK1, a splicing factor regulator, and inhibits its activity. Therefore, E4 favors expression of late viral transcripts by inhibiting SRPK1-mediated phosphorylation of host serine-arginine (SR) proteins that have critical roles in mRNA metabolism. Late in the infectious cycle, E4 also acts to diminish the integrity of the keratinocyte by disrupting the keratin cytoskeleton and inducing apoptosis through alteration of mitochondrial function to facilitate egress of the newly formed virions.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.7 kDa

References & Citations

"Sequence determination of human papillomavirus type 6a and assembly of virus-like particles in Saccharomyces cerevisiae." Hofmann K.J., Cook J.C., Joyce J.G., Brown D.R., Schultz L.D., George H.A., Rosolowsky M., Fife K.H., Jansen K.U. Virology 209:506-518 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929248/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal NRK1 Antibody
NBP1-79662 100 µL

Rabbit Polyclonal NRK1 Antibody

Ask
View Details
LOC668357 siRNA (m)
sc-148898 10 µM

LOC668357 siRNA (m)

Ask
View Details
Fish GTP-Binding Protein 1 (GTPBP1) ELISA Kit
MBS9921322 Inquire

Fish GTP-Binding Protein 1 (GTPBP1) ELISA Kit

Ask
View Details
CD322 / JAM2 Polyclonal Antibody
ANT-11112-100ug 100 µg

CD322 / JAM2 Polyclonal Antibody

Ask
View Details