Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Activin RIB/ALK-4, Rhesus Macaque (HEK293, Fc)

Activin RIB, also known as activin receptor type-1B (ACVR1B) or ALK-4, is a type I transmembrane serine/threonine kinase receptor that is part of the TGF-β receptor superfamily. Activin binds to a type II activin receptor (ACVR2or ACVR2B) and then recruits ACVR1B[1][2][3]. Activin RIB/ALK-4 Protein, Rhesus Macaque (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 100 amino acids (R27-E126) .

Product Specifications

Product Name Alternative

Activin RIB/ALK-4 Protein, Rhesus Macaque (HEK293, Fc), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/activin-rib-alk-4-protein-rhesus-macaque-hek293-fc.html

Purity

97.0

Smiles

RGIQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE

Molecular Formula

696587 (Gene_ID) I2CYX8/NP_001252559.1 (R27-E126) (Accession)

Molecular Weight

Approximately 43-45 kDa due to the glycosylation.

References & Citations

[1]Dev Dyn, et al. Developmental analysis of activin-like kinase receptor-4 (ALK4) expression in Xenopus laevis. . 2005 Feb;232 (2) :393-8.|[2]Qian Wang, et al. Activin Receptor-Like Kinase 4 Haplodeficiency Mitigates Arrhythmogenic Atrial Remodeling and Vulnerability to Atrial Fibrillation in Cardiac Pathological Hypertrophy. J Am Heart Assoc. 2018 Aug 21;7 (16) :e008842.|[3]Wanglong Qiu, et al. Conditional activin receptor type 1B (Acvr1b) knockout mice reveal hair loss abnormality. J Invest Dermatol. 2011 May;131 (5) :1067-76.|[4]G H Su, et al. ACVR1B (ALK4, activin receptor type 1B) gene mutations in pancreatic carcinoma. Proc Natl Acad Sci U S A. 2001 Mar 13;98 (6) :3254-7.|[5]Kamil Matulka, et al. PTP1B is an effector of activin signaling and regulates neural specification of embryonic stem cells. Cell Stem Cell. 2013 Dec 5;13 (6) :706-19.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

BC007926 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
13069061 1.0 µg DNA

BC007926 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Anti-Granzyme B/GZMB Antibody Picoband®, Carrier-free
PA1738-carrier-free 100 µg/Vial

Anti-Granzyme B/GZMB Antibody Picoband®, Carrier-free

Ask
View Details
Ku-70 Polyclonal Antibody
MBS2537415-01 0.02 mL

Ku-70 Polyclonal Antibody

Ask
View Details
Ku-70 Polyclonal Antibody
MBS2537415-02 0.06 mL

Ku-70 Polyclonal Antibody

Ask
View Details
Ku-70 Polyclonal Antibody
MBS2537415-03 0.12 mL

Ku-70 Polyclonal Antibody

Ask
View Details
Ku-70 Polyclonal Antibody
MBS2537415-04 0.2 mL

Ku-70 Polyclonal Antibody

Ask
View Details