Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transient receptor potential cation channel subfamily V member 4 (Trpv4), partial

Product Specifications

Product Name Alternative

TrpV4; Osm-9-like TRP channel 4; OTRPC4; Transient receptor potential protein 12; TRP12; Vanilloid receptor-like channel 2; Vanilloid receptor-like protein 2; Vanilloid receptor-related osmotically-activated channel; VR-OAC

Abbreviation

Recombinant Mouse Trpv4 protein, partial

Gene Name

Trpv4

UniProt

Q9EPK8

Expression Region

723-871aa

Organism

Mus musculus (Mouse)

Target Sequence

GQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADEVVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Non-selective calcium permeant cation channel involved in osmotic sensitivity and mechanosensitivity. Activation by exposure to hypotonicity within the physiological range exhibits an outward rectification. Also activated by heat, low pH, citrate and phorbol esters. Increase of intracellular Ca (2+) potentiates currents. Channel activity seems to be regulated by a calmodulin-dependent mechanism with a negative feedback mechanism. Acts as a regulator of intracellular Ca (2+) in synoviocytes. Plays an obligatory role as a molecular component in the nonselective cation channel activation induced by 4-alpha-phorbol 12,13-didecanoate and hypotonic stimulation in synoviocytes and also regulates production of IL-8. Together with PKD2, forms mechano- and thermosensitive channels in cilium. Promotes cell-cell junction formation in skin keratinocytes and plays an important role in the formation and/or maintenance of functional intercellular barriers. Negatively regulates expression of PPARGC1A, UCP1, oxidative metabolism and respiration in adipocytes. Regulates expression of chemokines and cytokines related to pro-inflammatory pathway in adipocytes. Together with AQP5, controls regulatory volume decrease in salivary epithelial cells. Required for normal development and maintenance of bone and cartilage. In its inactive state, may sequester DDX3X at the plasma membrane. When activated, the interaction between both proteins is affected and DDX3X relocalizes to the nucleus.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12936004/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

OLR651 Adenovirus (Rat)
34567056 1.0 ml

OLR651 Adenovirus (Rat)

Ask
View Details
MC11 PS UK AJ Spare Parts and Accessories
302743 Pack of 1 Piece(s)

MC11 PS UK AJ Spare Parts and Accessories

Ask
View Details
NMNAT-3 Double Nickase Plasmid (m2)
sc-428711-NIC-2 20 µg

NMNAT-3 Double Nickase Plasmid (m2)

Ask
View Details
c-IAP1 (F-4) HRP
sc-271419 HRP 200 µg/mL

c-IAP1 (F-4) HRP

Ask
View Details
CBFB (NM_022845) Human Tagged Lenti ORF Clone
RC211623L1 10 µg

CBFB (NM_022845) Human Tagged Lenti ORF Clone

Ask
View Details
Regulator of Nonsense Transcripts 3B (UPF3B) Antibody
abx122400-01 100 µg

Regulator of Nonsense Transcripts 3B (UPF3B) Antibody

Ask
View Details