Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF11B/OPG, Human (HEK293, His)

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (HEK293, His) is a recombinant human TNFRSF11B/OPG (E22-L401) with C-terminal 6*His tag, which is produced in HEK293 cell[1][2].

Product Specifications

Product Name Alternative

TNFRSF11B/OPG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf11b-opg-protein-human-hek-293-his.html

Purity

97.00

Smiles

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Formula

4982 (Gene_ID) O00300 (E22-L401) (Accession)

Molecular Weight

54-60 kDa

References & Citations

[1]Boyce BF, et al. Biology of RANK, RANKL, and osteoprotegerin. Arthritis Res Ther. 2007;9 Suppl 1 (Suppl 1) :S1.|[2]Wang Y, et al. The roles of osteoprotegerin in cancer, far beyond a bone player. Cell Death Discov. 2022 May 6;8 (1) :252.|[3]Venuraju SM, et al. Osteoprotegerin as a predictor of coronary artery disease and cardiovascular mortality and morbidity. J Am Coll Cardiol. 2010 May 11;55 (19) :2049-61.|[4]Capparelli C, et al. Sustained antiresorptive effects after a single treatment with human recombinant osteoprotegerin (OPG) : a pharmacodynamic and pharmacokinetic analysis in rats. J Bone Miner Res. 2003 May;18 (5) :852-8.|[5]Candido R, et al. Human full-length osteoprotegerin induces the proliferation of rodent vascular smooth muscle cells both in vitro and in vivo. J Vasc Res. 2010;47 (3) :252-61.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ME2 Antibody [DyLight 594]
NBP2-99375DL594 0.1 mL

Rabbit Polyclonal ME2 Antibody [DyLight 594]

Ask
View Details
Azidobutyric acid NHS ester
A8147-25 25 mg

Azidobutyric acid NHS ester

Ask
View Details
ASPRV1 Protein Vector (Mouse) (pPM-C-HA)
12567024 500 ng

ASPRV1 Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
Diethyl Fumarate
TRC-D444495-25G 25 g

Diethyl Fumarate

Ask
View Details
BGN, ID (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)
MBS6465266-01 0.2 mL

BGN, ID (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)

Ask
View Details
BGN, ID (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)
MBS6465266-02 5x 0.2 mL

BGN, ID (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)

Ask
View Details