Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFRSF11B/OPG, Human (HEK293, His)

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (HEK293, His) is a recombinant human TNFRSF11B/OPG (E22-L401) with C-terminal 6*His tag, which is produced in HEK293 cell[1][2].

Product Specifications

Product Name Alternative

TNFRSF11B/OPG Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tnfrsf11b-opg-protein-human-hek-293-his.html

Purity

97.00

Smiles

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Formula

4982 (Gene_ID) O00300 (E22-L401) (Accession)

Molecular Weight

54-60 kDa

References & Citations

[1]Boyce BF, et al. Biology of RANK, RANKL, and osteoprotegerin. Arthritis Res Ther. 2007;9 Suppl 1 (Suppl 1) :S1.|[2]Wang Y, et al. The roles of osteoprotegerin in cancer, far beyond a bone player. Cell Death Discov. 2022 May 6;8 (1) :252.|[3]Venuraju SM, et al. Osteoprotegerin as a predictor of coronary artery disease and cardiovascular mortality and morbidity. J Am Coll Cardiol. 2010 May 11;55 (19) :2049-61.|[4]Capparelli C, et al. Sustained antiresorptive effects after a single treatment with human recombinant osteoprotegerin (OPG) : a pharmacodynamic and pharmacokinetic analysis in rats. J Bone Miner Res. 2003 May;18 (5) :852-8.|[5]Candido R, et al. Human full-length osteoprotegerin induces the proliferation of rodent vascular smooth muscle cells both in vitro and in vivo. J Vasc Res. 2010;47 (3) :252-61.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mannose 1-phosphate
HY-16304 1 Each

Mannose 1-phosphate

Ask
View Details
PLV3-CMV-ECFP-MCS-FLAG-EF1a-Fluc-Neo Plasmid
PVT75620 2 µg

PLV3-CMV-ECFP-MCS-FLAG-EF1a-Fluc-Neo Plasmid

Ask
View Details
ZFAND5 (NM_001278245) Human Untagged Clone
SC334505 10 µg

ZFAND5 (NM_001278245) Human Untagged Clone

Ask
View Details
CINP Polyclonal Antibody, Cy5.5 Conjugated
bs-9077R-Cy5.5 100 µL

CINP Polyclonal Antibody, Cy5.5 Conjugated

Ask
View Details
Rabbit Polyclonal Salivary Amylase Alpha Antibody
NBP3-35327-20ul 20 µL

Rabbit Polyclonal Salivary Amylase Alpha Antibody

Ask
View Details