Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein kinase Nek7 (NEK7)

Product Specifications

Product Name Alternative

(Never in mitosis A-related kinase 7) (NimA-related protein kinase 7)

Abbreviation

Recombinant Human NEK7 protein

Gene Name

NEK7

UniProt

Q8TDX7

Expression Region

1-302aa

Organism

Homo sapiens (Human)

Target Sequence

MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Protein kinase which plays an important role in mitotic cell cycle progression. Required for microtubule nucleation activity of the centrosome, robust mitotic spindle formation and cytokinesis. Phosphorylates RPS6KB1. Phosphorylates EML4 at 'Ser-146', promoting its dissociation from microtubules during mitosis which is required for efficient chromosome congression. Essential protein for NLRP3 inflammasome assembly and activation that acts downstream stimuli such as K (+) efflux. Dispensable for the induction of core inflammasome components, but necessary for subsequent formation of the NLRP3:PYCARD complex, and activation of CASP1. Serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division. Exerts its effects on the NLRP3 inflammasome independently of its kinase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

47.5 kDa

References & Citations

"Mitotic phosphorylation by NEK6 and NEK7 reduces the microtubule affinity of EML4 to promote chromosome congression." Adib R., Montgomery J.M., Atherton J., O'Regan L., Richards M.W., Straatman K.R., Roth D., Straube A., Bayliss R., Moores C.A., Fry A.M. Sci. Signal. 12:0-0 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12932672/

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Ras-related protein R-Ras, Rras ELISA KIT
ELI-45295m 96 Tests

Mouse Ras-related protein R-Ras, Rras ELISA KIT

Ask
View Details
Caspase-4 Polyclonal Antibody
E20-70657 100ug

Caspase-4 Polyclonal Antibody

Ask
View Details
Mouse Monoclonal RSK4 Antibody (8E8)
H00027330-M04 0.1 mg

Mouse Monoclonal RSK4 Antibody (8E8)

Ask
View Details
Hdac2 Mouse Gene Knockout Kit (CRISPR)
KN307617 1 Kit

Hdac2 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Gpr158-set siRNA/shRNA/RNAi Lentivector (Mouse)
22524094 4 x 500 ng

Gpr158-set siRNA/shRNA/RNAi Lentivector (Mouse)

Ask
View Details