Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial

Product Specifications

Product Name Alternative

180 kDa secretory phospholipase A2 receptor C-type lectin domain family 13 member C M-type receptor

Abbreviation

Recombinant Human PLA2R1 protein, partial

Gene Name

PLA2R1

UniProt

Q13018

Expression Region

395-530aa

Organism

Homo sapiens (Human)

Target Sequence

EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

Receptor for secretory phospholipase A2 (sPLA2) . Acts as a receptor for phospholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.3 kDa

References & Citations

"The human 180-kDa receptor for secretory phospholipases A2. Molecular cloning, identification of a secreted soluble form, expression, and chromosomal localization." Ancian P., Lambeau G., Mattei M.-G., Lazdunski M. J. Biol. Chem. 270:8963-8970 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929901/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KCNN4 (SK4) Polyclonal Antibody
MBS2549366-01 0.02 mL

KCNN4 (SK4) Polyclonal Antibody

Ask
View Details
KCNN4 (SK4) Polyclonal Antibody
MBS2549366-02 0.06 mL

KCNN4 (SK4) Polyclonal Antibody

Ask
View Details
KCNN4 (SK4) Polyclonal Antibody
MBS2549366-03 0.12 mL

KCNN4 (SK4) Polyclonal Antibody

Ask
View Details
KCNN4 (SK4) Polyclonal Antibody
MBS2549366-04 0.2 mL

KCNN4 (SK4) Polyclonal Antibody

Ask
View Details
Recombinant S. aureus Peptide deformylase Protein, His, Yeast-10ug
QP6478-ye-10ug 10ug

Recombinant S. aureus Peptide deformylase Protein, His, Yeast-10ug

Ask
View Details