Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ephrin-A1/EFNA1, Human (HEK293, His)

Ephrin-A1/EFNA1 Protein is a member of the A-type ephrin family of cell surface proteins that function as ligands for the A-type Eph receptor tyrosine kinase family (EphA2) . EFNA1 exerts its function largely through interactions with EphA2. EFNA1 exists in a soluble form as well as a glycophosphatidylinositol (GPI) membrane attached form. EFNA1 acts as a membrane-bound, GPI-anchored protein capable of mediating juxtacrine signalling and requiring membrane attachment or clustering/oligomerization. EFNA1 is a novel TNF-inducible protein. EFNA1 efficiently binds to the EphA8 receptor expressed in NIH3T3 fibroblasts. EFNA1 stimulates PI3K activity via direct interaction of EphA2 with the p85 subunit of PI3K. EFNA1 can both inhibit and stimulate oncogenesis, depending on the cellular context[1][2][3]. Ephrin-A1/EFNA1 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A1/EFNA1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Ephrin-A1/EFNA1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ephrin-a1-efna1-protein-human-hek-293-his.html

Purity

95.0

Smiles

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Molecular Formula

1942 (Gene_ID) NP_004419.2 (D19-S182) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD40/TNFRSF5 Antibody (T8P2G4/A6)
NBP2-50284 0.1 mL

Mouse Monoclonal CD40/TNFRSF5 Antibody (T8P2G4/A6)

Ask
View Details
Cytosolic Non-Specific Dipeptidase (CNDP2) Antibody
abx456837-01 50 µg

Cytosolic Non-Specific Dipeptidase (CNDP2) Antibody

Ask
View Details
Cytosolic Non-Specific Dipeptidase (CNDP2) Antibody
abx456837-02 100 µg

Cytosolic Non-Specific Dipeptidase (CNDP2) Antibody

Ask
View Details
LAMB2 Protein Lysate (Mouse) with C-HA Tag
26276034 100 μg

LAMB2 Protein Lysate (Mouse) with C-HA Tag

Ask
View Details
RASSF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
38554064 1.0 µg DNA

RASSF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Ask
View Details