Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ER membrane protein complex subunit 10 (EMC10), partial

Product Specifications

Product Name Alternative

(Hematopoietic signal peptide-containing membrane domain-containing protein 1)

Abbreviation

Recombinant Human EMC10 protein, partial

Gene Name

EMC10

UniProt

Q5UCC4

Expression Region

26-221aa

Organism

Homo sapiens (Human)

Target Sequence

RGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable) . Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.9 kDa

References & Citations

"hHSS1: a novel secreted factor and suppressor of glioma growth located at chromosome 19q13.33." Junes-Gill K.S., Gallaher T.K., Gluzman-Poltorak Z., Miller J.D., Wheeler C.J., Fan X., Basile L.A. J. Neurooncol. 102:197-211 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934353/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit
MBS9338554-01 48 Well

Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit

Ask
View Details
Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit
MBS9338554-02 96 Well

Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit

Ask
View Details
Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit
MBS9338554-03 5x 96 Well

Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit

Ask
View Details
Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit
MBS9338554-04 10x 96 Well

Human Ubiquitin carboxyl-terminal hydrolase 30, USP30 ELISA Kit

Ask
View Details
Ptk2b AAV siRNA Pooled Vector
38110166 1.0 μg

Ptk2b AAV siRNA Pooled Vector

Ask
View Details
PCTAIRE2 (CDK17) (NM_002595) Human 3' UTR Clone
SC217313 10 µg

PCTAIRE2 (CDK17) (NM_002595) Human 3' UTR Clone

Ask
View Details