Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Toll-like receptor 4 (TLR4), partial

Product Specifications

Product Name Alternative

HToll (CD284)

Abbreviation

Recombinant Human TLR4 protein, partial

Gene Name

TLR4

UniProt

O00206

Expression Region

27-631aa

Organism

Homo sapiens (Human)

Target Sequence

EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Cardiovascular

Relevance

Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide . Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response . Also involved in LPS-independent inflammatory responses triggered by free fatty acids, such as palmitate, and Ni2+. Responses triggered by Ni2+ require non-conserved histidines and are, therefore, species-specific . Both M.tuberculosis HSP70 and HSP65 act via this protein to stimulate NF-kappa-B expression . In complex with TLR6, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion. Binds electronegative LDL and mediates the cytokine release induced by LDL- . Stimulation of monocytes in vitro with M.tuberculosis PstS1 induces p38 MAPK and ERK1/2 activation primarily via TLR2, but also partially via this receptor .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

69.8 kDa

References & Citations

"Lipopolysaccharide is in close proximity to each of the proteins in its membrane receptor complex. transfer from CD14 to TLR4 and MD-2." da Silva Correia J., Soldau K., Christen U., Tobias P.S., Ulevitch R.J. J. Biol. Chem. 276:21129-21135 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12927630/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

B-Cell Linker Protein (BLNK) Antibody (FITC)
abx317562-01 20 µg

B-Cell Linker Protein (BLNK) Antibody (FITC)

Ask
View Details
B-Cell Linker Protein (BLNK) Antibody (FITC)
abx317562-02 50 µg

B-Cell Linker Protein (BLNK) Antibody (FITC)

Ask
View Details
B-Cell Linker Protein (BLNK) Antibody (FITC)
abx317562-03 100 µg

B-Cell Linker Protein (BLNK) Antibody (FITC)

Ask
View Details
B-Cell Linker Protein (BLNK) Antibody (FITC)
abx317562-04 200 µg

B-Cell Linker Protein (BLNK) Antibody (FITC)

Ask
View Details
B-Cell Linker Protein (BLNK) Antibody (FITC)
abx317562-05 1 mg

B-Cell Linker Protein (BLNK) Antibody (FITC)

Ask
View Details
MAP1LC3BP1 Human qPCR Primer Pair (XM_095897)
HP221072 200 Reactions

MAP1LC3BP1 Human qPCR Primer Pair (XM_095897)

Ask
View Details