Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KGF/FGF-7, Human (N-His)

KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.

Product Specifications

Product Name Alternative

KGF/FGF-7 Protein, Human (N-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kgf-fgf-7-protein-human-his.html

Purity

96.00

Smiles

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Molecular Formula

2252 (Gene_ID) P21781-1 (C32-T194) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7) . J Biol Chem. 2002 Nov 8;277 (45) :42815-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-01 0.1 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details
PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-02 0.2 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details
PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-03 0.5 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details
PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-04 1 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details
PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-05 5 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details
PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)
MBS2126407-06 5x 5 mL

PE-Linked Polyclonal Antibody to Phospholipase A2, Group III (PLA2G3)

Ask
View Details