Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Virulence sensor histidine kinase PhoQ (phoQ), partial

Product Specifications

Product Name Alternative

(Sensor histidine protein kinase/phosphatase PhoQ)

Abbreviation

Recombinant Salmonella typhimurium phoQ protein, partial

Gene Name

PhoQ

UniProt

P0DM80

Expression Region

215-487aa

Organism

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Target Sequence

WWSLRPIEALAREVRELEDHHREMLNPETTRELTSLVRNLNQLLKSERERYNKYRTTLTDLTHSLKTPLAVLQSTLRSLRNEKMSVSKAEPVMLEQISRISQQIGYYLHRASMRGSGVLLSRELHPVAPLLDNLISALNKVYQRKGVNISMDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLHIFVEDDGPGIPHSKRSLVFDRGQRADTLRPGQGVGLAVAREITEQYAGQIIASDSLLGGARMEVVFGRQHPTQKEE

Tag

N-terminal 10xhis-tagged and C-terminal myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Member of the two-component regulatory system PhoP/PhoQ which regulates the expression of genes involved in virulence, adaptation to acidic and low Mg (2+) environments and resistance to host defense antimicrobial peptides. Essential for intramacrophage survival of S.typhimurium. In low periplasmic Mg (2+), PhoQ functions as a membrane-associated protein kinase that undergoes autophosphorylation and subsequently transfers the phosphate to PhoP, resulting in the expression of PhoP-activated genes (PAG) and repression of PhoP-repressed genes (PRG) . In high periplasmic Mg (2+), acts as a protein phosphatase that dephosphorylates phospho-PhoP, resulting in the repression of PAG and may lead to expression of some PRG. Essential for transcription of spiC inside macrophages by controlling the expression of the two-component regulatory system SsrB/SpiR (SsrA) and Pir at transcriptional and post-transcriptional levels respectively. Promotes expression of the two-component regulatory system PmrA/PmrB via activation of pmrD gene. Is required to attenuate bacterial growth within fibroblast cells and to enhance bacterial resistance to bile in intestinal cells. Negatively regulates prgH, which is required for invasion of epithelial cells. Involved in acid tolerance.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.5 kDa

References & Citations

"Functional reconstitution of the Salmonella typhimurium PhoQ histidine kinase sensor in proteoliposomes." Sanowar S., Le Moual H. Biochem. J. 390:769-776 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12933083/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)
MBS6394967-01 0.1 mL

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)

Ask
View Details
SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)
MBS6394967-02 5x 0.1 mL

SPO11 (Meiotic Recombination Protein SPO11, Cancer/testis Antigen 35, CT35) (MaxLight 550)

Ask
View Details
TM6SF1 (NM_023003) Human Tagged Lenti ORF Clone
RC224527L3 10 µg

TM6SF1 (NM_023003) Human Tagged Lenti ORF Clone

Ask
View Details
APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)
MBS2058572-01 0.1 mL

APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)

Ask
View Details
APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)
MBS2058572-02 0.2 mL

APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)

Ask
View Details
APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)
MBS2058572-03 0.5 mL

APC-Linked Polyclonal Antibody to Hexokinase 3, White Cell (HK3)

Ask
View Details