Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly [ADP-ribose] polymerase 9 (PARP9), partial

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 9 B aggressive lymphoma protein Poly [ADP-ribose] polymerase 9

Abbreviation

Recombinant Human PARP9 protein, partial

Gene Name

PARP9

UniProt

Q8IXQ6

Expression Region

628-854aa

Organism

Homo sapiens (Human)

Target Sequence

IQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cancer

Relevance

ADP-ribosyltransferase which, in association with E3 ligase DTX3L, plays a role in DNA damage repair and in immune responses including interferon-mediated antiviral defenses (PubMed:16809771, PubMed:23230272, PubMed:26479788, PubMed:27796300) . Within the complex, enhances DTX3L E3 ligase activity which is further enhanced by PARP9 binding to poly (ADP-ribose) (PubMed:28525742) . In association with DTX3L and in presence of E1 and E2 enzymes, mediates NAD+-dependent mono-ADP-ribosylation of ubiquitin which prevents ubiquitin conjugation to substrates such as histones (PubMed:28525742) . During DNA repair, PARP1 recruits PARP9/BAL1-DTX3L complex to DNA damage sites via PARP9 binding to ribosylated PARP1 (PubMed:23230272) . Subsequent PARP1-dependent PARP9/BAL1-DTX3L-mediated ubiquitination promotes the rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80, and BRCA1 to DNA damage sites (PubMed:23230272, PubMed:28525742) . In response to DNA damage, PARP9-DTX3L complex is required for efficient non-homologous end joining (NHEJ) ; the complex function is negatively modulated by PARP9 activity (PubMed:28525742) . Dispensable for B-cell receptor (BCR) assembly through V (D) J recombination and class switch recombination (CSR) (By similarity) . In macrophages, positively regulates pro-inflammatory cytokines production in response to IFNG stimulation by suppressing PARP14-mediated STAT1 ADP-ribosylation and thus promoting STAT1 phosphorylation (PubMed:27796300) . Also suppresses PARP14-mediated STAT6 ADP-ribosylation (PubMed:27796300) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.0 kDa

References & Citations

"PARP9-DTX3L ubiquitin ligase targets host histone H2BJ and viral 3C protease to enhance interferon signaling and control viral infection." Zhang Y., Mao D., Roswit W.T., Jin X., Patel A.C., Patel D.A., Agapov E., Wang Z., Tidwell R.M., Atkinson J.J., Huang G., McCarthy R., Yu J., Yun N.E., Paessler S., Lawson T.G., Omattage N.S., Brett T.J., Holtzman M.J. Nat. Immunol. 16:1215-1227 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12929395/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal ZMYM1 Antibody [mFluor Violet 500 SE]
NBP1-76523MFV500 0.1 mL

Rabbit Polyclonal ZMYM1 Antibody [mFluor Violet 500 SE]

Ask
View Details
Recombinant Amylase, Alpha 2A (AMY2A)
RPB454Mu02-01 10 µg

Recombinant Amylase, Alpha 2A (AMY2A)

Ask
View Details
Recombinant Amylase, Alpha 2A (AMY2A)
RPB454Mu02-02 50 µg

Recombinant Amylase, Alpha 2A (AMY2A)

Ask
View Details
Recombinant Amylase, Alpha 2A (AMY2A)
RPB454Mu02-03 100 µg

Recombinant Amylase, Alpha 2A (AMY2A)

Ask
View Details
Recombinant Amylase, Alpha 2A (AMY2A)
RPB454Mu02-04 200 µg

Recombinant Amylase, Alpha 2A (AMY2A)

Ask
View Details
Recombinant Amylase, Alpha 2A (AMY2A)
RPB454Mu02-05 500 µg

Recombinant Amylase, Alpha 2A (AMY2A)

Ask
View Details