Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GFRAL, Human (His-SUMO)

The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (His-SUMO) is the recombinant human-derived GFRAL protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

GFRAL Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gfral-protein-human-his-sumo.html

Purity

93.00

Smiles

SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Molecular Formula

389400 (Gene_ID) Q6UXV0 (S19-E351) (Accession)

Molecular Weight

Approximately 53.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal vWF-A2 Antibody [DyLight 550]
NBP3-06544R 0.1 mL

Rabbit Polyclonal vWF-A2 Antibody [DyLight 550]

Ask
View Details
NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (AP)
MBS6132558-01 0.1 mL

NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (AP)

Ask
View Details
NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (AP)
MBS6132558-02 5x 0.1 mL

NFATC3 (Nuclear Factor of Activated T-cells, Cytoplasmic 3, NF-ATc3, NFATc3, NFATx, T-cell Transcription Factor NFAT4, NF-AT4, NFAT4) (AP)

Ask
View Details
EN1 Antibody, FITC conjugated
A20580-50UG 50 µg

EN1 Antibody, FITC conjugated

Ask
View Details
Human WDR35 siRNA
abx906064-01 15 nmol

Human WDR35 siRNA

Ask
View Details
Human WDR35 siRNA
abx906064-02 30 nmol

Human WDR35 siRNA

Ask
View Details