Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Plexin-A1 (PLXNA1), partial

Product Specifications

Product Name Alternative

Semaphorin receptor NOV

Abbreviation

Recombinant Human PLXNA1 protein, partial

Gene Name

PLXNA1

UniProt

Q9UIW2

Expression Region

32-296aa

Organism

Homo sapiens (Human)

Target Sequence

RAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Coreceptor for SA3A, SA3C, SA3F and SA6D. Necessary for signaling by class 3 saphorins and subsequent rodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 saphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific saphorins, and its Cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, invasive growth and cell migration. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity) .

Molecular Weight

33.3 kDa

References & Citations

Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12550024/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-01 0.01 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details
Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-02 0.05 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details
Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-03 0.1 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details
Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-04 0.2 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details
Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-05 0.5 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details
Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)
MBS2030727-06 1 mg

Recombinant Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1)

Ask
View Details