IFN-alpha 6/IFNA6, Human (His-Myc)

SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKE

[1]Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27 (2) :240-52.|[2]Zhang SY, et al. Inborn errors of interferon (IFN) -mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.|[3]Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266 (17) :11360-5.|[4]Cull VS, et al. Type I interferon gene therapy protects against cytomegalovirus-induced myocarditis. Immunology. 2002 Jul;106 (3) :428-37.