Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

4-1BBL/TNFSF9, Cynomolgus (HEK293, Fc)

4-1BBL (4-1BB ligand) is a type II membrane protein of the TNF superfamily, is expressed on antigen-presenting cells. 4-1BB with 4-1BBL can induce T-cell expansion, cytokine induction, differentiation, and upregulation of anti-apoptotic genes as well as protect T cells from activation-induced cell death (AICD) [1]. 4-1BBL stimulates T cell proliferation and induces effective anti-tumor immune responses[3]. 4-1BBL is an immunostimulant molecule that interacts with the 4-1BB high-affinity receptor during the antigen presentation, providing costimulatory signals to both CD4+ and CD8+ T cells through the activation of NF-kB, c-Jun, and p38 downstream pathways, triggering pleiotropic effects on the immune system[4]. 4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc) is a recombinant protein with a N-Terminal Fc label, It consists of 184 amino acids (R68-E251) and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

4-1BBL/TNFSF9 Protein, Cynomolgus (HEK293, Fc), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/4-1bbl-tnfsf9-protein-cynomolgus-hek293-fc.html

Purity

98.0

Smiles

REGPELSPDNPAGLLDLRQGMFAQLVAQNVLLTDGPLSWYSDPGLAGVSLAEGLSYKEDTKELVVAKAGVYYVFLQLMLQRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPSASSEARNSAFGFQGRLLHLGAGQRLGVHLHTEARACHAWQLTQGATVLGLFRVTPEVPAGLSSPRSE

Molecular Formula

102129676 (Gene_ID) XP_015296398 (R68-E251) (Accession)

Molecular Weight

Approximately 47.8 kDa.

References & Citations

[1]Li Y, et al. Limited Cross-Linking of 4-1BB by 4-1BB Ligand and the Agonist Monoclonal Antibody Utomilumab. Cell Rep. 2018 Oct 23;25 (4) :909-920.e4.|[2]Bitra A, et al. Crystal structure of the m4-1BB/4-1BBL complex reveals an unusual dimeric ligand that undergoes structural changes upon 4-1BB receptor binding. J Biol Chem. 2019 Feb 8;294 (6) :1831-1845.|[3]Meseck M, et al. A functional recombinant human 4-1BB ligand for immune costimulatory therapy of cancer. J Immunother. 2011 Mar;34 (2) :175-82.|[4]Martinez-Perez AG, et al. 4-1BBL as a Mediator of Cross-Talk between Innate, Adaptive, and Regulatory Immunity against Cancer. Int J Mol Sci. 2021 Jun 9;22 (12) :6210.|[5]Salih HR, et al. Soluble CD137 (4-1BB) ligand is released following leukocyte activation and is found in sera of patients with hematological malignancies. J Immunol. 2001 Oct 1;167 (7) :4059-66.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VRK2 Protein Lysate
OCOA12187-20UG 20 µg

VRK2 Protein Lysate

Ask
View Details
Copg1 (NM_017477) Mouse Tagged Lenti ORF Clone
MR211034L3 10 µg

Copg1 (NM_017477) Mouse Tagged Lenti ORF Clone

Ask
View Details
IFluor® 555 Anti-human CD45 Antibody *UCHL1*
10456090-AAT 100 Tests

IFluor® 555 Anti-human CD45 Antibody *UCHL1*

Ask
View Details
Sheep Na+/Ca2+exchanger ELISA Kit
OM617514 96 Strip Well

Sheep Na+/Ca2+exchanger ELISA Kit

Ask
View Details
P2RY8
FP-332 100 µL - 10 Tests

P2RY8

Ask
View Details