Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIKV E1

Source: Escherichia Coli.Sterile filtered colorless solution.Chikungunya is an infection caused by the chikungunya virus which is passed to humans by two species of mosquito of the genus Aedes: A. albopictus and A. aegypti. Animal reservoirs of the virus include monkeys, birds, cattle, and rodents. The features of the disease are a sudden onset of fever 2-4 days after exposure. The fever typically lasts 2-7 days, while the associated joint pains usually last weeks or months but sometimes years. The mortality rate is a little less than 1 in 1,000. The disease has occurred in outbreaks in Asia, Europe and the Americas since 2004. CHIKV is a single-stranded positive-sense RNA genome, 11,800 nts long which encodes 2 open reading frames. The nucleocapsid is tightly enveloped by a host-derived lipid bilayer (envelope) supporting the virus-encoded envelope proteins. 80 glycoprotein spikes are C- terminally anchored within the viral envelope. The structural polyprotein is translated from a viral sub genomic mRNA, while as the 5 structural proteins (capsid, E3, E2, 6K, E1) are translated as a single polyprotein, from which capsid (C) is cleaved off to encapsidate. The envelope polyprotein precursor E3-E2-6K-E1 is translocated to the endoplasmatic reticulum. Polyprotein is processed by host signalases, resulting in E3, E2 & E1 forming viral hetero-trimeric spikes. The viral spikes majorly contains E2 and E1 facilitate cell receptor recognition, cell entry thru pH-dependent endocytosis and support viral budding.Recombinant Chikungunya E1 produced in E.coli having a molecular weight of 48kDa.

Product Specifications

Product Name Alternative

Chikungunya is an infection caused by the chikungunya virus which is passed to humans by two species of mosquito of the genus Aedes: A. albopictus and A. aegypti. Animal reservoirs of the virus include monkeys, birds, cattle, and rodents. The features of the disease are a sudden onset of fever 2-4

Purification

Protein is >90% pure as determined by SDS-PAGE.

Components

Sterile Filtered solution containing PBS.

Storage Conditions

CHIKV E1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

PNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKSLPDYSC KVFTGVYPFMWGGAYCFCDTENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNVTVSAY ANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESEDVYAN TQLVLQRPSAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAMNCAVGNMPISIDIPDAAF TRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTAL ASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQDISVTAMSWVQKITG
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-MUC1 (clone huC242)-SMCC-DM1 ADC
ADC-W-545 1 mg

Anti-MUC1 (clone huC242)-SMCC-DM1 ADC

Ask
View Details
GAB1 (pY627) Antibody
MBS8582243-01 0.1 mL

GAB1 (pY627) Antibody

Ask
View Details
GAB1 (pY627) Antibody
MBS8582243-02 0.1 mL (AF635)

GAB1 (pY627) Antibody

Ask
View Details
GAB1 (pY627) Antibody
MBS8582243-03 0.1 mL (AF610)

GAB1 (pY627) Antibody

Ask
View Details
GAB1 (pY627) Antibody
MBS8582243-04 0.1 mL (AF405S)

GAB1 (pY627) Antibody

Ask
View Details
GAB1 (pY627) Antibody
MBS8582243-05 0.1 mL (AF405L)

GAB1 (pY627) Antibody

Ask
View Details