Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LILRA5/CD85f (C-6His)

Source: Human Cells. MW :26.1kD. Recombinant Human Leukocyte Immunoglobulin-like Receptor Subfamily A Member 5 is produced by our Mammalian expression system and the target gene encoding Gly42-Arg268 is expressed with a 6His tag at the C-terminus. Leukocyte Immunoglobulin-like Receptor Subfamily A Member 5 (LILRA5) is a member of the leukocyte immunoglobulin-like receptors (LILR), comprise a family of activating and inhibitory type immunoreceptors. LILRA5 consists of a 227 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 10 aa cytoplasmic tail. The ECD contains two Ig-like domains and the transmembrane segment contains a positively charged aspartic acid residue which may mediate its association with the signaling molecule, FcR common gamma chain. LILRA5 is expressed by monocytes, macrophages, and neutrophils. Cross-linking of LILRA5 on monocytes induces the expression of pro-inflammatory cytokines (IL-1beta, IL-6, TNF-alpha) as well as the anti-inflammatory IL-10. It can be detected in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Crosslink of ILT-11 on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses.

Product Specifications

Gene Name

LILRA5

Gene ID

353514

UniProt

A6NI73

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIRHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pBluescriptR-FNDC9 Plasmid
PVT17027 2 µg

pBluescriptR-FNDC9 Plasmid

Ask
View Details
Rat Monoclonal B7-H2/ICOSLG Antibody (599829) [DyLight 594]
MAB1581DL594 0.1 mL

Rat Monoclonal B7-H2/ICOSLG Antibody (599829) [DyLight 594]

Ask
View Details
Lentiviral human ADGRG7 sgRNA gene knockout kit - Lentiviral human ADGRG7 sgRNA gene knockout kit (25)
GTR15385899 1 Vial

Lentiviral human ADGRG7 sgRNA gene knockout kit - Lentiviral human ADGRG7 sgRNA gene knockout kit (25)

Ask
View Details
LentimiRa-rno-miR-1839-3p Vector
mr40579 500 ng

LentimiRa-rno-miR-1839-3p Vector

Ask
View Details
Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase
MBS1342529-01 0.02 mg (E-Coli)

Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase

Ask
View Details
Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase
MBS1342529-02 0.1 mg (E-Coli)

Recombinant Bacillus sp. (strain GL1) Unsaturated glucuronyl hydrolase

Ask
View Details