Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon Lambda-2/IL-28A (C-6His)

Source: Human cells. MW :20.6kD. Recombinant Human Interferon Lambda-2 is produced by our Mammalian expression system and the target gene encoding Val26-Val200 is expressed with a 6His tag at the C-terminus. IL-28A (Interferon-lambda2? IFN-lambda2), IL-28B/IFN-lambda3, and IL-29/IFN-lambda1 are type III interferons which are distantly related to IL-10 family and type I IFN family cytokines. Mature human IL-28A is an approximately 22-25 kDa protein that shares 66% amino acid (aa) sequence identity with mouse and rat IL-28A and shows cross-species activity. It shares 96% and 70% aa sequence identity with human IL-28B and IL-29, respectively. IL-28A promotes the Th1 polarization of dendritic cells in the airway and inhibits Th2 and Th17 mediated inflammation. IL-28A additionally exhibits anti-tumor activity, in part by enhancing IL-12 dependent anti-tumor CTL responses in vivo. In contrast, it is up-regulated in invasive bladder cancer where it promotes tumor cell migration.

Product Specifications

Gene Name

IFNL2

Gene ID

282616

UniProt

Q8IZJ0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal TRIM5 alpha Antibody [Alexa Fluor 700]
NBP1-76600AF700 0.1 mL

Rabbit Polyclonal TRIM5 alpha Antibody [Alexa Fluor 700]

Ask
View Details
IMMT Mouse Monoclonal Antibody
AMM83602-01 1 Each

IMMT Mouse Monoclonal Antibody

Ask
View Details
IMMT Mouse Monoclonal Antibody
AMM83602-02 50 µL

IMMT Mouse Monoclonal Antibody

Ask
View Details
IMMT Mouse Monoclonal Antibody
AMM83602-03 100 µL

IMMT Mouse Monoclonal Antibody

Ask
View Details
ZNF639 3'UTR Lenti-reporter-Luc Vector
51688081 1.0 µg

ZNF639 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Rabbit Polyclonal OXTR Antibody
NBP2-82300-0.1mL 0.1 mL

Rabbit Polyclonal OXTR Antibody

Ask
View Details