Recombinant Human S100A7
Source: E. coli. MW :11.5kD. Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed. S100A7 is a 11-12 kDa member of the S100 family of EF hand calcium binding proteins. Human S100A7 shares 32% amino acid sequence identity with mouse S100A7A, the closest related protein in mouse. It is acetylated at the N-terminus and binds both calcium and zinc ions. S100A7 is up-regulated in keratinocytes of psoriasis and atopic dermatitis lesions, as well as in epithelial cells of the tongue, eye, and female genital tract. Its up-regulation can be induced by bacterial exposure, inflammatory cytokines, or epidermal barrier disruption. S100A7 supports epithelial integrity through killing E. coli by sequestration of zinc and through inducing the up-regulation of tight junction proteins. The interaction of S100A7 with RAGE promotes the migration of immune cells and the infiltration of macrophages into tumor sites.
Product Specifications
Gene Name
S100A7
Gene ID
6278
UniProt
P31151
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items