Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100A7

Source: E. coli. MW :11.5kD. Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed. S100A7 is a 11-12 kDa member of the S100 family of EF hand calcium binding proteins. Human S100A7 shares 32% amino acid sequence identity with mouse S100A7A, the closest related protein in mouse. It is acetylated at the N-terminus and binds both calcium and zinc ions. S100A7 is up-regulated in keratinocytes of psoriasis and atopic dermatitis lesions, as well as in epithelial cells of the tongue, eye, and female genital tract. Its up-regulation can be induced by bacterial exposure, inflammatory cytokines, or epidermal barrier disruption. S100A7 supports epithelial integrity through killing E. coli by sequestration of zinc and through inducing the up-regulation of tight junction proteins. The interaction of S100A7 with RAGE promotes the migration of immune cells and the infiltration of macrophages into tumor sites.

Product Specifications

Gene Name

S100A7

Gene ID

6278

UniProt

P31151

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human PLGF / PGF (19-170) Protein, His Tag
PGF-H5229-20ug 20 µg

Human PLGF / PGF (19-170) Protein, His Tag

Ask
View Details
FluoroSpot Path: Human immunotherapy potency (3-color)
FSP-013609-TD-2 2 Plates

FluoroSpot Path: Human immunotherapy potency (3-color)

Ask
View Details
PRAK (MAPKAPK5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]
TA804353AM 100 µL

PRAK (MAPKAPK5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F5]

Ask
View Details
PGPEP1 (NM_017712) Human Tagged ORF Clone Lentiviral Particle
RC214837L1V 200 µL

PGPEP1 (NM_017712) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
CHRNA6 Rabbit Polyclonal Antibody
AP55108SU-N 200 µL

CHRNA6 Rabbit Polyclonal Antibody

Ask
View Details