Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement Component C3a/C3a

Source: E.coli. MW :9.1kD. Recombinant Human Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser672-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.

Product Specifications

Gene Name

C3

Gene ID

718

UniProt

P01024

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SVQLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLAR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TCR beta Antibody
DF8621-01 100 µL

TCR beta Antibody

Ask
View Details
TCR beta Antibody
DF8621-02 200 µL

TCR beta Antibody

Ask
View Details
pCR4-TOPO-PROKR2 Plasmid
PVT33028 2 µg

pCR4-TOPO-PROKR2 Plasmid

Ask
View Details
DACH2 (NM_001139514) Human Over-expression Lysate
LC427975 20 µg

DACH2 (NM_001139514) Human Over-expression Lysate

Ask
View Details