Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement Factor D/Adipsin (C-10His)

Source: Human Cells. MW :26.8kD. Recombinant Mouse Complement factor D is produced by our Mammalian expression system and the target gene encoding Ile26-Ser259 is expressed with a 10His tag at the C-terminus. Complement factor D, also known as adipsin, is a member of the chymotrypsin family of serine proteases, which plays an essential role in host defense as the rate-limiting enzyme in the alternative pathway of complement activation. Complement factor D activates a convertase (C3bBb) responsible for cleavage of the complement protein C3, which leads to the activation of terminal complement component C5-9 to form the membrane attack complex on microbial or cellular surfaces. It also functions in the regulation of systemic energy balance and physiologic and pathologic processes, including immunity and inflammation.

Product Specifications

Gene Name

Cfd

Gene ID

11537

UniProt

P03953

Components

Lyophilized from a 0.2 μm filtered solution of 20mMTris,150mMNaCl, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ILGGQEAAAHARPYMASVQVNGTHVCGGTLLDEQWVLSAAHCMDGVTDDDSVQVLLGAHSLSAPEPYKRWYDVQSVVPHPGSRPDSLEDDLILFKLSQNASLGPHVRPLPLQYEDKEVEPGTLCDVAGWGVVTHAGRRPDVLHQLRVSIMNRTTCNLRTYHDGVVTINMMCAESNRRDTCRGDSGSPLVCGDAVEGVVTWGSRVCGNGKKPGVYTRVSSYRMWIENITNGNMTSHHHHHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-01 10 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details
3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-02 100 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details
3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-03 25 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details
3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-04 5 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details
3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-05 50 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details
3'-O-MOE-G (iBu) -2'-phosphoramidite
MF-0056776-06 500 mg

3'-O-MOE-G (iBu) -2'-phosphoramidite

Ask
View Details