Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement Component C3a/C3a

Source: E.coli. MW :9.2kD. Recombinant Mouse Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser671-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.

Product Specifications

Gene Name

C3

Gene ID

12266

UniProt

P01027

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CREB1 (Cyclic AMP-responsive Element-binding Protein 1, CREB-1, cAMP-responsive Element-binding Protein 1) (MaxLight 550)
125311-ML550 100 µL

CREB1 (Cyclic AMP-responsive Element-binding Protein 1, CREB-1, cAMP-responsive Element-binding Protein 1) (MaxLight 550)

Ask
View Details
VPS29 CRISPRa sgRNA lentivector (set of three targets)(Human)
50179121 3x 1.0µg DNA

VPS29 CRISPRa sgRNA lentivector (set of three targets)(Human)

Ask
View Details
FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (MaxLight 490)
MBS6297587-01 0.1 mL

FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (MaxLight 490)

Ask
View Details
FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (MaxLight 490)
MBS6297587-02 5x 0.1 mL

FABP7, CT (FABP7, BLBP, FABPB, MRG, Fatty acid-binding protein, brain, Brain lipid-binding protein, Brain-type fatty acid-binding protein, Fatty acid-binding protein 7, Mammary-derived growth inhibitor related) (MaxLight 490)

Ask
View Details
Human CKB (Creatine Kinase, Brain) ELISA Kit
RE2456H-01 48 Tests

Human CKB (Creatine Kinase, Brain) ELISA Kit

Ask
View Details
Human CKB (Creatine Kinase, Brain) ELISA Kit
RE2456H-02 96 Tests

Human CKB (Creatine Kinase, Brain) ELISA Kit

Ask
View Details