Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement Component C3a/C3a

Source: E.coli. MW :9.2kD. Recombinant Mouse Complement Component C3a is produced by our E.coli expression system and the target gene encoding Ser671-Arg748 is expressed. Complement is defined as key part of innate immunity and as the first line of defense in the fight against invading pathogens. Complement 3 (C3) is the most abundant component of the complement cascade and the convergent point for all three major complement activation pathways: namely classical, alternative and mannose-binding lectin pathways. Complement activation leads to the formation of the C3 convertase, which cleaves C3 into the key effector molecules, C3a (anaphylatoxin) and C3b (opsonin) which then drive microbe removal. By binding to C3a receptor (C3aR), C3a exhibits potent anaphylatoxin activity, including increased vascular permeability, triggering degranulation of mast cells, inflammation, and activating leukocytes.

Product Specifications

Gene Name

C3

Gene ID

12266

UniProt

P01027

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SOX21 (SRY (Sex Determining Region Y) -Box 21, SOX25) (MaxLight 405) discontinued
251977-ML405 100 µL

SOX21 (SRY (Sex Determining Region Y) -Box 21, SOX25) (MaxLight 405) discontinued

Ask
View Details
Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-01 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Ask
View Details
Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-02 5x 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Ask
View Details
Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit
abx493271-03 10x 96 Tests

Mouse Leucine Rich alpha 2-Glycoprotein 1 (LRG1) CLIA Kit

Ask
View Details
NDRG3 Rabbit monoclonal antibody
BS41402-01 50 µL

NDRG3 Rabbit monoclonal antibody

Ask
View Details
NDRG3 Rabbit monoclonal antibody
BS41402-02 100 µL

NDRG3 Rabbit monoclonal antibody

Ask
View Details