Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming Growth Factor beta-1/TGF beta1/TGFB1

Source: Human Cells. MW :12.8kD. Recombinant Mouse Transforming Growth Factor beta 1 is produced by our Mammalian expression system and the target gene encoding Ala279-Ser390 is expressed. Transforming growth factor beta 1 (TGF beta1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF- beta1, TGF- beta2 and TGF- beta3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF- beta receptor type II (T betaR-II), and a TGF- beta receptor type I (T betaR-I) . Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF- beta expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

Product Specifications

Gene Name

Tgfb1

Gene ID

21803

UniProt

P04202

Components

Lyophilized from a 0.2 μm filtered solution of 50mM Glycine,150mM NaCl, pH 2.5.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ERCC8 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62393R-PE-Cy5.5 100 µL

ERCC8 Recombinant Antibody, PE-Cy5.5 Conjugated

Ask
View Details
LPO Human Pre-designed siRNA Set A
HY-RS07773 1 Set

LPO Human Pre-designed siRNA Set A

Ask
View Details
Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein
RPU54870-01 50 µg

Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein

Ask
View Details
Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein
RPU54870-02 100 µg

Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein

Ask
View Details
Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein
RPU54870-03 1 mg

Mouse Colony Stimulating Factor 1, Macrophage (MCSF), Active Protein

Ask
View Details
Peli1 (NM_023324) Mouse Recombinant Protein
TP506617 20 µg

Peli1 (NM_023324) Mouse Recombinant Protein

Ask
View Details