Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GM-CSF/CSF2

Source: E.coli. MW :14.2kD. Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Ala18-Lys141 is expressed. Granulocyte-macrophage colony-stimulating factor is an enzyme that in mouse is encoded by the Csf2 gene, belongs to the GM-CSF family.CSF2 is a Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes

Product Specifications

Gene Name

Csf2

Gene ID

12981

UniProt

P01587

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details
Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-02 0.05 mg (Baculovirus)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details
Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-03 0.5 mg (Yeast)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details
Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-04 0.05 mg (Mammalian-Cell)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details
Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-05 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details
Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial
MBS1460945-06 0.1 mg (Baculovirus)

Recombinant Arabidopsis thaliana Syntaxin-73 (SYP73), partial

Ask
View Details