Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement Factor H/CFH (C-6His)

Source: Human Cells. MW :50kD. Recombinant Human Complement factor H is produced by our Mammalian expression system and the target gene encoding Glu19-Leu449 is expressed with a 6His tag at the C-terminus. Complement Factor H (CFH) is a secreted protein which is a member of the regulators of complement activation family and is a complement control protein. It is expressed by the liver and secreted in plasma. Its principal function is to regulate the Alternative Pathway of the complement system, ensuring that the complement system is directed towards pathogens or other dangerous material and does not damage host tissue. Factor H regulates complement activation on self cells and surfaces by possessing both cofactor activity for the Factor I mediated C3b cleavage, and decay accelerating activity against the alternative pathway C3-convertase, C3bBb. Factor H exerts its protective action on self cells and self surfaces but not on the surfaces of bacteria or viruses, because it binds to glycosaminoglycans (GAGs) that are generally present on host cells but not, normally, on pathogen surfaces.

Product Specifications

Gene Name

CFH

Gene ID

3075

UniProt

P08603

Components

Supplied as a 0.2 μm filtered solution of PBS,20%Glycerol,5% Trehalose, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVSFTLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human RalB MAb (Clone 399417)
MAB3920-SP 25 µg

Human RalB MAb (Clone 399417)

Ask
View Details
Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit
MBS7216371-01 48 Well

Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit

Ask
View Details
Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit
MBS7216371-02 96 Well

Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit

Ask
View Details
Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit
MBS7216371-03 5x 96 Well

Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit

Ask
View Details
Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit
MBS7216371-04 10x 96 Well

Porcine Acetylcholine receptor subunit alpha (CHRNA1) ELISA Kit

Ask
View Details
EIF3A
480021 100 µL

EIF3A

Ask
View Details