Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Clusterin/APOJ (C-6His)

Source: Human Cells. MW :50.4kD. Recombinant Mouse Clusterin is produced by our Mammalian expression system and the target gene encoding Glu22-Glu448 is expressed with a 6His tag at the C-terminus. Clusterin (CLU) is a secreted protein which belongs to the clusterin family. It is also a 75 - 80 kDa disulfide-linked heterodimeric protein associated with the clearance of cellular debris and apoptosis. Clusterin is an enigmatic glycoprotein with a nearly ubiquitous tissue distribution and an apparent involvement in biological processes ranging from mammary gland involution to neurodegeneration in Alzheimer's disease. Its major form, a heterodimer, is secreted and present in physiological fluids, but truncated forms targeted to the nucleus have also been identified. It is a widely distributed glycoprotein with a wide range of biologic properties. A prominent and defining feature of clusterin is its marked induction in such disease states as glomerulonephritis, cystic renal disease, renal tubular injury, neurodegenerative conditions, atherosclerosis, and myocardial infarction. Upregulation of clusterin mRNA and protein levels detected in diverse disease states and in in vitro systems have led to suggestions that it functions in membrane lipid recycling, in apoptotic cell death, and as a stress-induced secreted chaperone protein, amongst others.

Product Specifications

Gene Name

Clu

Gene ID

12759

UniProt

Q06890

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAEVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

P53 Antibody / TP53
V4457-100UG 100 µg

P53 Antibody / TP53

Ask
View Details
CCNB1IP1 (Cyclin B1 Interacting Protein 1, E3 Ubiquitin Protein Ligase)
477377 100 µL

CCNB1IP1 (Cyclin B1 Interacting Protein 1, E3 Ubiquitin Protein Ligase)

Ask
View Details
Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]

Ask
View Details
Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]

Ask
View Details
Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]
E-AB-F1061M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD48 Antibody[156-4H9]

Ask
View Details
Recombinant Treponema pallidum Uncharacterized protein TP_0645 (TP_0645)
MBS1167047-01 0.02 mg (E-Coli)

Recombinant Treponema pallidum Uncharacterized protein TP_0645 (TP_0645)

Ask
View Details