Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Clusterin/APOJ (C-6His)

Source: Human Cells. MW :50.4kD. Recombinant Mouse Clusterin is produced by our Mammalian expression system and the target gene encoding Glu22-Glu448 is expressed with a 6His tag at the C-terminus. Clusterin (CLU) is a secreted protein which belongs to the clusterin family. It is also a 75 - 80 kDa disulfide-linked heterodimeric protein associated with the clearance of cellular debris and apoptosis. Clusterin is an enigmatic glycoprotein with a nearly ubiquitous tissue distribution and an apparent involvement in biological processes ranging from mammary gland involution to neurodegeneration in Alzheimer's disease. Its major form, a heterodimer, is secreted and present in physiological fluids, but truncated forms targeted to the nucleus have also been identified. It is a widely distributed glycoprotein with a wide range of biologic properties. A prominent and defining feature of clusterin is its marked induction in such disease states as glomerulonephritis, cystic renal disease, renal tubular injury, neurodegenerative conditions, atherosclerosis, and myocardial infarction. Upregulation of clusterin mRNA and protein levels detected in diverse disease states and in in vitro systems have led to suggestions that it functions in membrane lipid recycling, in apoptotic cell death, and as a stress-induced secreted chaperone protein, amongst others.

Product Specifications

Gene Name

Clu

Gene ID

12759

UniProt

Q06890

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EQEVSDNELQELSTQGSRYINKEIQNAVQGVKHIKTLIEKTNAERKSLLNSLEEAKKKKEDALEDTRDSEMKLKAFPEVCNETMMALWEECKPCLKHTCMKFYARVCRSGSGLVGQQLEEFLNQSSPFYFWMNGDRIDSLLESDRQQSQVLDAMQDSFARASGIIDTLFQDRFFARELHDPHYFSPIGFPHKRPHFLYPKSRLVRSLMSPSHYGPPSFHNMFQPFFEMIHQAQQAMDVQLHSPAFQFPDVDFLREGEDDRTVCKEIRRNSTGCLKMKGQCEKCQEILSVDCSTNNPAQANLRQELNDSLQVAERLTEQYKELLQSFQSKMLNTSSLLEQLNDQFNWVSQLANLTQGEDKYYLRVSTVTTHSSDSEVPSRVTEVVVKLFDSDPITVVLPEEVSKDNPKFMDTVAEKALQEYRRKSRAEVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MIRacle™ mmu-miR-7223-5p miRNA Agomir/Antagomir
AM2650 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-7223-5p miRNA Agomir/Antagomir

Ask
View Details
Vom2r7 Rat shRNA Plasmid (Locus ID 685557)
TL704061 1 Kit

Vom2r7 Rat shRNA Plasmid (Locus ID 685557)

Ask
View Details
CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)
abx335212-01 20 µg

CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)

Ask
View Details
CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)
abx335212-02 50 µg

CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)

Ask
View Details
CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)
abx335212-03 100 µg

CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)

Ask
View Details
CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)
abx335212-04 200 µg

CUB And Sushi Multiple Domains 3 (CSMD3) Antibody (FITC)

Ask
View Details