Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Persephin

Source: E. coli. MW :10.4kD. Recombinant Human Persephin is produced by our E.coli expression system and the target gene encoding Ala61-Gly156 is expressed. Persephin is a secreted protein, belongs to the glial cell linederived neurotrophic factor (GDNF) family of the TGF- beta superfamily. It shares 38-46% amino acid (aa) identity with family members GDNF, neurturin and artemin. It is expressed at very low levels in most tissues. Mature protein contains a signal sequence, a pro-domain and a 96 aa mature sequence with several cysteines that are conserved among family members. It circulates as an unglycosylated disulfide-linked homodimer. Like other GDNF family members, Persephin acts through engagement of GRFa4, a glycosylphosphatidylinositol (GPI) -linked GDNF receptor family Persephin is reported to promote both the survival and growth of central dopaminergic and motor neurons, and kidney development. These effects are correlated with the expression patterns of GFRa4, and RET.

Product Specifications

Gene Name

PSPN

Gene ID

5623

UniProt

O60542

Components

Lyophilized from a 0.2 μm filtered solution of 4mM HCl.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TAF2 (NM_003184) Human Tagged ORF Clone Lentiviral Particle
RC213159L3V 200 µL

TAF2 (NM_003184) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Tbck (NM_001134513) Rat Tagged Lenti ORF Clone
RR201762L3 10 µg

Tbck (NM_001134513) Rat Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Med15 shRNA (UAS) - Lentiviral mouse Med15 shRNA (UAS, iRFP) (25)
GTR15154598 1 Vial

Lentiviral mouse Med15 shRNA (UAS) - Lentiviral mouse Med15 shRNA (UAS, iRFP) (25)

Ask
View Details
Alexa Fluor® 488 anti-human CD14
GT14810 25 Tests

Alexa Fluor® 488 anti-human CD14

Ask
View Details
CKMT2 Overexpression Lysate (Native) - (Dry Ice)
NBL1-09223 0.1 mg

CKMT2 Overexpression Lysate (Native) - (Dry Ice)

Ask
View Details