Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement Component C8 gamma Chain/C8G (N-6His)

Source: E. coli. MW :22.6kD. Recombinant Human Complement component C8 gamma is produced by our E.coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus. Complement component C8 is a constituent of the membrane attack complex, C8 alpha, C8 beta and C8G. C8G is a secreted protein and comsists a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 alpha and C8 beta play an important role in complement-mediated bacterial killing together.C8 is involved in the formation of Membrane Attack Complex on bacterial cell membranes. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol. Patients lacking C8 are susceptible to certain bacterial infections.

Product Specifications

Gene Name

C8G

Gene ID

733

UniProt

P07360

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Acetyl-CoA ELISA Kit
MBS282299-01 48 Tests

Rat Acetyl-CoA ELISA Kit

Ask
View Details
Rat Acetyl-CoA ELISA Kit
MBS282299-02 96 Tests

Rat Acetyl-CoA ELISA Kit

Ask
View Details
Rat Acetyl-CoA ELISA Kit
MBS282299-03 5x 96 Tests

Rat Acetyl-CoA ELISA Kit

Ask
View Details
Rat Acetyl-CoA ELISA Kit
MBS282299-04 10x 96 Tests

Rat Acetyl-CoA ELISA Kit

Ask
View Details
Fam72a (NM_175382) Mouse Tagged ORF Clone
MG201041 10 µg

Fam72a (NM_175382) Mouse Tagged ORF Clone

Ask
View Details
Rat gamma glutamyl transpeptidase (GGT) ELISA Kit
NSL0858r 96 Tests

Rat gamma glutamyl transpeptidase (GGT) ELISA Kit

Ask
View Details