Recombinant Human Eukaryotic Translation Initiation Factor 5A-2/EIF5A2 (N-6His)

Source: E. coli. MW :18.9kD. Recombinant Human EIF5A2 is produced by our E.coli expression system and the target gene encoding Met1-Lys153 is expressed with a 6His tag at the N-terminus. EIF5A2 is a member of the eIF-5A family. It is a 153 amino acids protein that in humans is encoded by the EIF5A2 gene. EIF5A2 is expressed in ovarian and colorectal cancer cell lines and highly expressed in testis.It has an important function at the level of mRNA turnover and mediates effects of polyamines on neuronal process extension and survival. It plays an important role in brain development and function, and in skeletal muscle stem cell differentiation.

Product Specifications

Gene Name

EIF5A2

Gene ID

56648

UniProt

Q9GZV4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK