Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human a-Synuclein/SNCA

Source: E. coli. MW :14.7kD. Recombinant Human alpha-Synuclein is produced by our E.coli expression system and the target gene encoding Met1-Ala140 is expressed. Alpha-Synuclein (SNCA) is a member of the Synuclein family. SNCA is expressed principally in brain but also expressed in low concentrations in all tissues except liver. SNCA interacts with UCHL1, Phospholipase D and histones. SNCA can include beta- and gamma-synuclein. In addition, SNCA is an important regulatory component of vesicular transport in neuronal cells. It has been suggested that SNCA is related to the pathogenesis of Parkinson's Disease and neurodegenerative disorders. Defects in SNCA will lead to Dementia Lewy Body (DLB) .

Product Specifications

Gene Name

SNCA

Gene ID

6622

UniProt

P37840

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

GSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tube Rack, 16mm, Full Size, Red
456540R 1 Each

Tube Rack, 16mm, Full Size, Red

Ask
View Details
Frozen Tissue Sections, Breast
CS522343 5x 5 µm

Frozen Tissue Sections, Breast

Ask
View Details
Rat Adenosine A1 Receptor, ADORA1 ELISA KIT
E2884Ra-01 48 Well

Rat Adenosine A1 Receptor, ADORA1 ELISA KIT

Ask
View Details
Rat Adenosine A1 Receptor, ADORA1 ELISA KIT
E2884Ra-02 96 Well

Rat Adenosine A1 Receptor, ADORA1 ELISA KIT

Ask
View Details
Rat Adenosine A1 Receptor, ADORA1 ELISA KIT
E2884Ra-03 5x 96 Tests

Rat Adenosine A1 Receptor, ADORA1 ELISA KIT

Ask
View Details
Rat Adenosine A1 Receptor, ADORA1 ELISA KIT
E2884Ra-04 10x 96 Tests

Rat Adenosine A1 Receptor, ADORA1 ELISA KIT

Ask
View Details