Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VEGF-C (C-6His)

Source: Human Cells. MW :23.27kD. Recombinant Human Vascular Endothelial Growth Factor C is produced by our Mammalian expression system and the target gene encoding Phe32-Arg227 is expressed with a 6His tag at the C-terminus. Vascular Endothelial Growth Factor (VEGF) -C is a member of the VEGF family, a group of polypeptide growth factors which play key roles in the physiology and pathology of many aspects of the cardiovascular system, including vasculogenesis, hematopoiesis, angiogenesis and vascular permeability. While VEGFC is homologous to other members of the VEGF/PDGF family, it contains the C-terminal propeptide which has an unusual structure with tandemly repeated cysteine-rich motifs. Upon biosynthesis, VEGFC is secreted as a non-covalent momodimer in an anti-parellel fashion. VEGF signalling in endothelial cells occurs through three tyrosine kinase receptors (VEGFRs) expressed by endothelial cells and hematopoietic precursors, and VEGF-C is a ligand for two receptors, VEGFR-3 (Flt4), and VEGFR-2. It is indicated that VEGFC undergoes a complex proteolytic maturation generating a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGFC may function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Knockout of the VEGF-C gene is embryonic lethal late in development, and although cells differentiate into the lymphatic lineage, they fail to sprout and form lymphatic vessels. Inactivation of a single VEGF-C allele results in the development of cutaneous lymphatic hypoplasia and lymphedema.

Product Specifications

Gene Name

VEGFC

Gene ID

7424

UniProt

P49767

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Brorin/VWC2 Antibody (03)
NBP3-05796-100ul 100 µL

Mouse Monoclonal Brorin/VWC2 Antibody (03)

Ask
View Details
Ndufc2 (NM_001009290) Rat Tagged ORF Clone Lentiviral Particle
RR209312L4V 200 µL

Ndufc2 (NM_001009290) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Amylin ELISA Kit
CN-03816H1 96T

Human Amylin ELISA Kit

Ask
View Details
Rabbit Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit
YP-W73923-01 48 Tests

Rabbit Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit

Ask
View Details
Rabbit Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit
YP-W73923-02 96 Tests

Rabbit Intercellular Adhesion Molecule 3 (ICAM3) ELISA Kit

Ask
View Details
Rabbit Anti-F150B/ALKAL2 Polyclonal Antibody
PAV7099 100 μL

Rabbit Anti-F150B/ALKAL2 Polyclonal Antibody

Ask
View Details