Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat M-CSF/CSF1

Source: Human Cells. MW :25.2kD. Recombinant Rat Macrophage colony-stimulating factor 1 is produced by our Mammalian expression system and the target gene encoding Gln33-Arg254 is expressed. Rat Macrophage colony-stimulating factor 1 (MCSF, CSF1) is a single-pass type I membrane cytokine. It is a hematopoietic growth factor that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. MCSF promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It is involved in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development which for normal male and female fertility. It promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. MCSF also plays a role in lipoprotein clearance.

Product Specifications

Gene Name

Csf1

UniProt

Q8JZQ0

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cryopreserved Porcine Cardiac Valve Interstitial Cells (PCVIC)
P370-05 1 Cryovial

Cryopreserved Porcine Cardiac Valve Interstitial Cells (PCVIC)

Ask
View Details
Human Monoclonal EGFR Antibody (h-R3 (Nimotuzumab)) [Alexa Fluor 594]
NBP2-75186AF594 0.1 mL

Human Monoclonal EGFR Antibody (h-R3 (Nimotuzumab)) [Alexa Fluor 594]

Ask
View Details
Hepatitis C Virus NS5, Genotype 6a, Recombinant, GST-Tag (HCV)
H1920-29H-01 100 µg

Hepatitis C Virus NS5, Genotype 6a, Recombinant, GST-Tag (HCV)

Ask
View Details
Hepatitis C Virus NS5, Genotype 6a, Recombinant, GST-Tag (HCV)
H1920-29H-02 1 mg

Hepatitis C Virus NS5, Genotype 6a, Recombinant, GST-Tag (HCV)

Ask
View Details
Secretogranin-2, aa495-517, Rat (Secretogranin II)
302161 200 µg

Secretogranin-2, aa495-517, Rat (Secretogranin II)

Ask
View Details
Cysteamine Hydrochloride 98% For Synthesis
00922 00100 100 g

Cysteamine Hydrochloride 98% For Synthesis

Ask
View Details