Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL 19 Mouse

Source: Escherichia Coli.Sterile Filtered White lyophilized (freeze-dried) powder.IL19 is a cytokine that belongs to the IL10 cytokine subfamily. IL-19 is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3) . A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described.Interleukin-19 Mouse Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 153 amino acids and having a molecular mass of 17.7kDa. The IL-19 is purified by proprietary chromatographic techniques.

Product Specifications

Product Name Alternative

Interleukin-19, IL-19, Il19.

Purification

Greater than 95.0% as determined by SDS-PAGE.

Components

Lyophilized from a sterile filtered aqueous solution containing 5mM Na3PO4 and 150mM NaCl, pH 7.5.It is recommended to reconstitute the lyophilized IL-19 in sterile 18M-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Lyophilized Interleukin-19 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL19 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Amino Acids

MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GENLISA Human Phosphorylation Extracellular Signal Regulated Kinase1/2 (p-ERK1/2ï1⁄4‰ELISA
KBH14640 1x 96 Well

GENLISA Human Phosphorylation Extracellular Signal Regulated Kinase1/2 (p-ERK1/2ï1⁄4‰ELISA

Ask
View Details
PRKAR1A (cAMP-dependent Protein Kinase Type I-alpha Regulatory Subunit, Tissue-specific Extinguisher 1, TSE1, PRKAR1, PKR1, DKFZp779L0468, MGC17251)
131794 50 µg

PRKAR1A (cAMP-dependent Protein Kinase Type I-alpha Regulatory Subunit, Tissue-specific Extinguisher 1, TSE1, PRKAR1, PKR1, DKFZp779L0468, MGC17251)

Ask
View Details
Human CCND2 (Cyclin-D2) ELISA Kit
MBS2510030-01 24 Tests (Limit 1)

Human CCND2 (Cyclin-D2) ELISA Kit

Ask
View Details
Human CCND2 (Cyclin-D2) ELISA Kit
MBS2510030-02 48 Tests

Human CCND2 (Cyclin-D2) ELISA Kit

Ask
View Details
Human CCND2 (Cyclin-D2) ELISA Kit
MBS2510030-03 96 Tests

Human CCND2 (Cyclin-D2) ELISA Kit

Ask
View Details
Human CCND2 (Cyclin-D2) ELISA Kit
MBS2510030-04 5x 96 Tests

Human CCND2 (Cyclin-D2) ELISA Kit

Ask
View Details