Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant West Nile Pre-M Virus

Source : The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.

Product Specifications

Purification

Protein is >95% pure as determined by SDS-PAGE.

Components

20mM phosphate buffer pH 7.5.

Storage Conditions

WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.

Amino Acids

MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4-Amino Propofol Hydrochloride
002501 5 mg

4-Amino Propofol Hydrochloride

Ask
View Details
Caspase 8 (CASP8) (NM_001080124) Human Tagged Lenti ORF Clone
RC217147L3 10 µg

Caspase 8 (CASP8) (NM_001080124) Human Tagged Lenti ORF Clone

Ask
View Details
UBE2E2 (NM_152653) Human Recombinant Protein
TP304787L 1 mg

UBE2E2 (NM_152653) Human Recombinant Protein

Ask
View Details
Mouse Monoclonal EpCAM/TROP1 Antibody (rMOC-31) [Alexa Fluor 700]
NBP2-54521AF700 100 µL

Mouse Monoclonal EpCAM/TROP1 Antibody (rMOC-31) [Alexa Fluor 700]

Ask
View Details
EIF4E Rabbit Monoclonal Antibody [Clone ID: RM452]
TA398444 100 µL

EIF4E Rabbit Monoclonal Antibody [Clone ID: RM452]

Ask
View Details
SYVN1, CT (SYVN1, HRD1, KIAA1810, E3 ubiquitin-protein ligase synoviolin, Synovial apoptosis inhibitor 1) (MaxLight 750) discontinued
042545-ML750 100 µL

SYVN1, CT (SYVN1, HRD1, KIAA1810, E3 ubiquitin-protein ligase synoviolin, Synovial apoptosis inhibitor 1) (MaxLight 750) discontinued

Ask
View Details