Recombinant West Nile Pre-M Virus
Source : The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag. West Nile virus (WNV) is a virus of the family Flaviviridae part of the Japanese encephalitis (JE) antigenic complex of viruses. Image reconstructions and cryoelectron microscopyreveal a 45-50 nm virion covered with a relatively smooth proteinsurface. This structure is similar to virus; both belong to the genus flavivirus within the family Flaviviridae. WNV is a positive-sense, single strand of RNA, it is between 11,000 and 12,000 nucleotides long which encode seven non-structural proteins and three structural proteins. The RNA strand is held within a nucleocapsid formed from 12 kDaprotein blocks; the capsid is contained within a host-derived membrane altered by two viral glycoproteins.
Product Specifications
Purification
Protein is >95% pure as determined by SDS-PAGE.
Components
20mM phosphate buffer pH 7.5.
Storage Conditions
WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Amino Acids
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1, FKSG8, NEDD8-specific Protease 1, NEDP1, Protease, Cysteine 2, PRSC2) (MaxLight 650)
SENP8 (Sentrin-specific Protease 8, Sentrin/SUMO-specific Protease SENP8, Deneddylase-1, DEN1, FKSG8, NEDD8-specific Protease 1, NEDP1, Protease, Cysteine 2, PRSC2) (MaxLight 650)
