Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Tropic 1808

Source : Escherichia Coli. Tropic-1808 Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa.The Tpc1808 is purified by proprietary chromatographic techniques. Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.

Product Specifications

Product Name Alternative

Tropic 1808||Tpc1808.

Purification

Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.

Storage Conditions

Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles.

Amino Acids

MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS.
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal EphA5 Antibody (86731) [Allophycocyanin]
FAB541A 0.5 mL

Mouse Monoclonal EphA5 Antibody (86731) [Allophycocyanin]

Ask
View Details
MRE11A (MRE11 meiotic recombination 11 Homolog A (S. cerevisiae), ATLD, HNGS1, MRE11, MRE11B) (MaxLight 650)
248874-ML650 100 µL

MRE11A (MRE11 meiotic recombination 11 Homolog A (S. cerevisiae), ATLD, HNGS1, MRE11, MRE11B) (MaxLight 650)

Ask
View Details
Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100942-01 5x 96 Tests

Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Ask
View Details
Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100942-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Ask
View Details
Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100942-03 10x 96 Tests

Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Ask
View Details
Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)
MBS2100942-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Interleukin 2 Receptor Alpha (IL2Ra) Antibody Pair Kit (with Standard)

Ask
View Details