Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis elegans E3 ubiquitin-protein ligase hrd-like protein 1 (hrdl-1), partial
MBS1156544-01 1 mg (E-Coli)

Recombinant Caenorhabditis elegans E3 ubiquitin-protein ligase hrd-like protein 1 (hrdl-1), partial

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans E3 ubiquitin-protein ligase hrd-like protein 1 (hrdl-1), partial
MBS1156544-02 1 mg (Yeast)

Recombinant Caenorhabditis elegans E3 ubiquitin-protein ligase hrd-like protein 1 (hrdl-1), partial

Sign In for Pricing
View Details
ACAD11 Recombinant Protein (Human)
RP036391 100 µg

ACAD11 Recombinant Protein (Human)

Sign In for Pricing
View Details
Beta-Defensin 131 (DEFb131) Human ELISA Kit
C8410 96 Tests

Beta-Defensin 131 (DEFb131) Human ELISA Kit

Sign In for Pricing
View Details
LRFN2, CT (LRFN2, KIAA1246, SALM1, Leucine-rich repeat and fibronectin type-III domain-containing protein 2, Synaptic adhesion-like molecule 1) (MaxLight 750) discontinued
037927-ML750 100 µL

LRFN2, CT (LRFN2, KIAA1246, SALM1, Leucine-rich repeat and fibronectin type-III domain-containing protein 2, Synaptic adhesion-like molecule 1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
EoL-1
ARC0199 1 Million

EoL-1

Sign In for Pricing
View Details