Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ki-67/MKI67 Alexa Fluor 594 MAb (Clone 1297A)
IC7617T-100UG 100 µg

Human Ki-67/MKI67 Alexa Fluor 594 MAb (Clone 1297A)

Sign In for Pricing
View Details
Lentiviral human TNK2 shRNA (UAS) - Lentiviral human TNK2 shRNA (UAS) plasmid
GTR15312994 1 Vial

Lentiviral human TNK2 shRNA (UAS) - Lentiviral human TNK2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
SOAT2
577407-01 50 µL

SOAT2

Sign In for Pricing
View Details
SOAT2
577407-02 100 µL

SOAT2

Sign In for Pricing
View Details
Bone Sialoprotein, Human, aa201-211 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)
298126-01 100 µg

Bone Sialoprotein, Human, aa201-211 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)

Sign In for Pricing
View Details
Bone Sialoprotein, Human, aa201-211 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)
298126-02 1 mg

Bone Sialoprotein, Human, aa201-211 (Bone Sialoprotein 2, BSP2, Cell-Binding Sialoprotein, Integrin-Binding Sialoprotein)

Sign In for Pricing
View Details