Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tfg (NM_019678) AAV Particle
MR206237A1V 250 µL

Mouse Tfg (NM_019678) AAV Particle

Sign In for Pricing
View Details
Chicken lysozyme (LZM) Elisa Kit
EK780112 96 Well

Chicken lysozyme (LZM) Elisa Kit

Sign In for Pricing
View Details
DNA repair and recombination protein RAD54-Like (RAD54L) Mouse ELISA Kit
C9418 96 Tests

DNA repair and recombination protein RAD54-Like (RAD54L) Mouse ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal Claudin-1 Antibody (421203) [mFluor Violet 450 SE]
FAB4618MFV450 0.1 mL

Rat Monoclonal Claudin-1 Antibody (421203) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
SAFB Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62719R-BF488-01 20 µL

SAFB Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
SAFB Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62719R-BF488-02 100 µL

SAFB Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details