Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EMCN shRNA Plasmid
abx975193-01 150 µg

Mouse EMCN shRNA Plasmid

Sign In for Pricing
View Details
Mouse EMCN shRNA Plasmid
abx975193-02 300 µg

Mouse EMCN shRNA Plasmid

Sign In for Pricing
View Details
Human SCAND3 (ZBED9) activation kit by CRISPRa
GA114470 1 Kit

Human SCAND3 (ZBED9) activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Monoclonal Oval Cell Marker Antibody (MIC1-1C3) [Alexa Fluor 488]
NBP1-18961AF488 0.1 mL

Rat Monoclonal Oval Cell Marker Antibody (MIC1-1C3) [Alexa Fluor 488]

Sign In for Pricing
View Details
Vmn1r29 (NM_053232) Mouse Tagged ORF Clone Lentiviral Particle
MR224705L3V 200 µL

Vmn1r29 (NM_053232) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
KD-Validated Anti-CDC25C Rabbit Monoclonal Antibody
AGI1184-100 100 µL

KD-Validated Anti-CDC25C Rabbit Monoclonal Antibody

Sign In for Pricing
View Details