Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1/2/3/4 Rabbit Polyclonal Antibody
E28PT8004 100 µL

FGFR1/2/3/4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col2a1 (NM_031163) Mouse Tagged Lenti ORF Clone
MR212008L4 10 µg

Col2a1 (NM_031163) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
WRN, ID (T802) (WRN, RECQ3, RECQL2, Werner syndrome ATP-dependent helicase, DNA helicase, RecQ-like type 3, Exonuclease WRN, RecQ protein-like 2) (MaxLight 550) discontinued
043897-ML550 100 µL

WRN, ID (T802) (WRN, RECQ3, RECQL2, Werner syndrome ATP-dependent helicase, DNA helicase, RecQ-like type 3, Exonuclease WRN, RecQ protein-like 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PALMD Human siRNA Oligo Duplex (Locus ID 54873)
SR310304 1 Kit

PALMD Human siRNA Oligo Duplex (Locus ID 54873)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Flagellar L-ring protein (flgH)
MBS1255310-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Flagellar L-ring protein (flgH)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Flagellar L-ring protein (flgH)
MBS1255310-02 0.1 mg (E-Coli)

Recombinant Pseudomonas putida Flagellar L-ring protein (flgH)

Sign In for Pricing
View Details