Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Androgen receptor, Human (His-SUMO, Myc)

The androgen receptor protein is a steroid hormone receptor that acts as a ligand-activated transcription factor that regulates gene expression and affects cell proliferation and differentiation. Coactivators and corepressors such as ZBTB7A negatively regulate androgen receptor signaling by recruiting NCOR1 and NCOR2 to androgen response elements on target genes. Androgen receptor Protein, Human (His-SUMO, Myc) is the recombinant human-derived Androgen receptor protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Androgen receptor Protein, Human (His-SUMO, Myc), Human, E. coli

UNSPSC

12352202

Purity

91.00

Smiles

DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT

Molecular Formula

367 (Gene_ID) P10275-1 (D551-T919) (Accession)

Molecular Weight

Approximately 58 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Plekha3 shRNA (UAS) - Lentiviral mouse Plekha3 shRNA (UAS, iRFP) (100)
GTR15305718 1 Vial

Lentiviral mouse Plekha3 shRNA (UAS) - Lentiviral mouse Plekha3 shRNA (UAS, iRFP) (100)

Ask
View Details
Anti-SARS Envelope Protein
18958 1 Each

Anti-SARS Envelope Protein

Ask
View Details
Diphenylphosphinic Chloride
TRC-D492095-25G 25 g

Diphenylphosphinic Chloride

Ask
View Details
Human Toll Like Receptor 2 (TLR2) ELISA Kit
RDR-TLR2-Hu-01 96 Tests

Human Toll Like Receptor 2 (TLR2) ELISA Kit

Ask
View Details
Human Toll Like Receptor 2 (TLR2) ELISA Kit
RDR-TLR2-Hu-02 48 Tests

Human Toll Like Receptor 2 (TLR2) ELISA Kit

Ask
View Details
RWDD2A Antibody (Biotin)
abx311727-01 20 µg

RWDD2A Antibody (Biotin)

Ask
View Details