Testin, Human (His)
Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.
Product Specifications
Product Name Alternative
Testin Protein, Human (His), Human, E. coli
UNSPSC
12352202
Smiles
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
Molecular Formula
26136 (Gene_ID) Q9UGI8 (M1-S421) (Accession)
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
![Mouse Monoclonal Integrin beta 4/CD104 Antibody (UM-A9) [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-34507AF594 0.1 mL
Mouse Monoclonal Integrin beta 4/CD104 Antibody (UM-A9) [Alexa Fluor 594]
Ask
View Details 
MBS1346437-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Probable sucrose-phosphatase 3a (SPP3A)
Ask
View Details MBS1346437-02 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Probable sucrose-phosphatase 3a (SPP3A)
Ask
View Details MBS1346437-03 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Probable sucrose-phosphatase 3a (SPP3A)
Ask
View Details 
MBS1346437-04 0.1 mg (Yeast)
Recombinant Arabidopsis thaliana Probable sucrose-phosphatase 3a (SPP3A)
Ask
View Details