Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Testin, Human (His)

Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Testin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS

Molecular Formula

26136 (Gene_ID) Q9UGI8 (M1-S421) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit
MBS2602797-01 48 Well

Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit

Ask
View Details
Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit
MBS2602797-02 96 Well

Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit

Ask
View Details
Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit
MBS2602797-03 5x 96 Well

Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit

Ask
View Details
Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit
MBS2602797-04 10x 96 Well

Rat suppressors of cytokine signaling 1, SOCS-1 ELISA Kit

Ask
View Details
MC38-Mouse-PDL1 Overexpressing Cell Line
RG-1446 5x 10^6

MC38-Mouse-PDL1 Overexpressing Cell Line

Ask
View Details
Human Monoclonal Prokineticin R1/PROKR1 Antibody (Multiple seq-one in animal) [PE]
NBP3-27975PE 0.1 mL

Human Monoclonal Prokineticin R1/PROKR1 Antibody (Multiple seq-one in animal) [PE]

Ask
View Details