Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Testin, Human (His)

Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Testin Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS

Molecular Formula

26136 (Gene_ID) Q9UGI8 (M1-S421) (Accession)

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Bfar Pre-designed siRNA Set A
SI201400A 1 Each

Rat Bfar Pre-designed siRNA Set A

Ask
View Details
Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody
FY-AB37199-01 1 mL

Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody

Ask
View Details
Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody
FY-AB37199-02 100 µL

Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody

Ask
View Details
Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody
FY-AB37199-03 200 µL

Anti-Transglutaminase 3, Epidermal (TGM3) Monoclonal antibody

Ask
View Details
Rat CSF2 Protein, Fc Tag
PR168 5 µg

Rat CSF2 Protein, Fc Tag

Ask
View Details
Rabepk Rat siRNA Oligo Duplex (Locus ID 296649)
SR513084 1 Kit

Rabepk Rat siRNA Oligo Duplex (Locus ID 296649)

Ask
View Details