Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB, Human (Active, sf9, GST)

PPP1CB Protein, Human (Active, sf9, GST) is the recombinant human-derived PPP1CB protein, expressed by Sf9 insect cells, with N-GST tag.

Product Specifications

Product Name Alternative

PPP1CB Protein, Human (Active, sf9, GST), Human, Sf9 insect cells

UNSPSC

12352202

Smiles

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Molecular Formula

5500 (Gene_ID) P62140 (M1-R327) (Accession)

Molecular Weight

Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI3C6]
CF807081 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI3C6]

Ask
View Details
Recombinant Burkholderia sp. Bifunctional protein glk (glk)
MBS7015787-01 0.02 mg

Recombinant Burkholderia sp. Bifunctional protein glk (glk)

Ask
View Details
Recombinant Burkholderia sp. Bifunctional protein glk (glk)
MBS7015787-02 0.1 mg

Recombinant Burkholderia sp. Bifunctional protein glk (glk)

Ask
View Details
Recombinant Burkholderia sp. Bifunctional protein glk (glk)
MBS7015787-03 5x 0.1 mg

Recombinant Burkholderia sp. Bifunctional protein glk (glk)

Ask
View Details