PPP1CB, Human (Active, sf9, GST)
PPP1CB Protein, Human (Active, sf9, GST) is the recombinant human-derived PPP1CB protein, expressed by Sf9 insect cells, with N-GST tag.
Product Specifications
Product Name Alternative
PPP1CB Protein, Human (Active, sf9, GST), Human, Sf9 insect cells
UNSPSC
12352202
Smiles
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Molecular Formula
5500 (Gene_ID) P62140 (M1-R327) (Accession)
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items