Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERT, Human (His)

TERT Protein, Human (His) is the recombinant human-derived TERT protein, expressed by E. coli, with N-6*His tag.

Product Specifications

Product Name Alternative

TERT Protein, Human (His), Human, E. coli

UNSPSC

12352202

Smiles

EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA

Molecular Formula

7015 (Gene_ID) O14746-1 (E281-A436) (Accession)

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TLK1 (Tousled-like Kinase 1, Serine/threonine-protein Kinase Tousled-like 1, KIAA0137, PKU-beta) (Biotin)
134481-Biotin 100 µL

TLK1 (Tousled-like Kinase 1, Serine/threonine-protein Kinase Tousled-like 1, KIAA0137, PKU-beta) (Biotin)

Ask
View Details
5-Allyl-5-methallyl-barbituric Acid
434815-01 5 mg

5-Allyl-5-methallyl-barbituric Acid

Ask
View Details
5-Allyl-5-methallyl-barbituric Acid
434815-02 10 mg

5-Allyl-5-methallyl-barbituric Acid

Ask
View Details
Lentiviral human TINAG sgRNA gene knockout kit - Lentiviral human TINAG sgRNA gene knockout kit (plasmid)
GTR15400910 1 Vial

Lentiviral human TINAG sgRNA gene knockout kit - Lentiviral human TINAG sgRNA gene knockout kit (plasmid)

Ask
View Details